• <tr id="7r76l"></tr>
    <ins id="7r76l"><option id="7r76l"><menu id="7r76l"></menu></option></ins>
  • <ins id="7r76l"></ins>
    <ruby id="7r76l"><nav id="7r76l"></nav></ruby>
    <mark id="7r76l"></mark>
  • <menuitem id="7r76l"></menuitem>
    <output id="7r76l"><track id="7r76l"><delect id="7r76l"></delect></track></output>

    <menuitem id="7r76l"></menuitem>

    新型冠狀病毒基因組序列信息

    LOCUS       Exported               29903 bp ds-DNA     linear   VRL 19-JAN-2020
    DEFINITION  Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete 
                genome.
    ACCESSION   MN908947
    VERSION     .
    KEYWORDS    .
    SOURCE      Wuhan seafood market pneumonia virus
      ORGANISM  Wuhan seafood market pneumonia virus
    REFERENCE   1  (bases 1 to 29903)
      AUTHORS   Wu F, Zhao S, Yu B, Chen Y-M., Wang W, Hu Y, Song Z-G., Tao Z-W., 
                Tian J-H., Pei Y-Y., Yuan ML, Zhang Y-L., Dai F-H., Liu Y, Wang 
                Q-M., Zheng J-J., Xu L, Holmes EC, Zhang Y-Z.
      TITLE     A novel coronavirus associated with a respiratory disease in Wuhan 
                of Hubei province, China
      JOURNAL   Unpublished
    REFERENCE   2  (bases 1 to 29903)
      AUTHORS   Wu F, Zhao S, Yu B, Chen Y-M., Wang W, Hu Y, Song Z-G., Tao Z-W., 
                Tian J-H., Pei Y-Y., Yuan ML, Zhang Y-L., Dai F-H., Liu Y, Wang 
                Q-M., Zheng J-J., Xu L, Holmes EC, Zhang Y-Z.
      TITLE     Direct Submission
      JOURNAL   
    REFERENCE   3  (bases 1 to 29903)
      AUTHORS   .
      TITLE     Direct Submission
      JOURNAL   Exported Tuesday, Jan 21, 2020 from SnapGene Viewer 5.0.7
                https://www.snapgene.com
    COMMENT     On Jan 17, 2020 this sequence version replaced 
                MN908947.2.##Assembly-Data-START##
                Assembly Method       :: Megahit v. V1.1.3
                Sequencing Technology :: Illumina
                ##Assembly-Data-END##
    FEATURES             Location/Qualifiers
         source          1..29903
                         /organism="Wuhan seafood market pneumonia virus"
                         /host="Homo sapiens"
                         /isolate="Wuhan-Hu-1"
                         /mol_type="genomic RNA"
                         /country="China"
                         /db_xref="taxon:2697049"
         5'UTR           1..265
         gene            266..21555
                         /gene="orf1ab"
                         /label=orf1ab
         CDS             266..21555
                         /codon_start=1
                         /ribosomal_slippage
                         /gene="orf1ab"
                         /product="orf1ab polyprotein (pp1ab)"
                         /label=orf1ab
                         /note="translated by -1 ribosomal frameshift"
                         /protein_id="QHD43415.1"
                         /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQH
                         LKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETL
                         GVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNT
                         KHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFI
                         DTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSII
                         KTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKAT
                         CEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRK
                         GGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEK
                         VNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAK
                         KGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQY
                         SLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKF
                         KEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSII
                         IGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLT
                         EEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNT
                         FTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEF
                         ACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDED
                         EEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVG
                         QQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEE
                         AKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSG
                         HNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCV
                         DTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQR
                         KQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAP
                         YIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAK
                         TVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTI
                         QRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEE
                         AARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQS
                         TQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINL
                         HTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTT
                         DPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQD
                         AYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCG
                         QQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYE
                         LKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYT
                         TTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCD
                         NIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVW
                         HVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEV
                         VENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKP
                         NELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYM
                         PYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLIN
                         IIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIP
                         CSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAI
                         MQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCN
                         SSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTF
                         ISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVN
                         LDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGD
                         SAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGF
                         VDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
                         AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIA
                         LKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTR
                         DIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTT
                         NGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDT
                         NVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAG
                         VCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVA
                         IVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLT
                         FYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSF
                         STFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAAC
                         CHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTL
                         NGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCV
                         LKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC
                         GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNV
                         LAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLD
                         MCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLL
                         TILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSL
                         ATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDD
                         GARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMC
                         VEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFR
                         YMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLR
                         VESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRA
                         TLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQ
                         RKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCV
                         PLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISM
                         DNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTT
                         KGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGL
                         NNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITN
                         CVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI
                         PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARL
                         TPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFS
                         NYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEG
                         NCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAM
                         RNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAES
                         HVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFN
                         VLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLV
                         YAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEG
                         SSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINAN
                         QVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISA
                         KNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDV
                         ENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVM
                         CGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRL
                         YECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVL
                         YYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVD
                         DIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYS
                         VMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCY
                         DHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVF
                         GLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSY
                         GIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDA
                         VVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVA
                         NYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLP
                         IDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLS
                         VVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRC
                         PAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRN
                         PAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFN
                         VAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHP
                         TQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEA
                         IRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSA
                         KPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKY
                         FVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSN
                         HDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHM
                         VVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHS
                         DKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDK
                         SAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYR
                         LYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPV
                         SIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANT
                         VIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVL
                         ITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQ
                         EFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKE
                         SPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVK
                         VTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD
                         SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPT
                         GTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
                         TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGC
                         NYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQIN
                         DMILSLLSKGRLIIRENNRVVISSDVLVNN"
         gene            21563..25384
                         /gene="S"
                         /label=S
         CDS             21563..25384
                         /codon_start=1
                         /gene="S"
                         /product="surface glycoprotein"
                         /label=S
                         /note="structural protein"
                         /protein_id="QHD43416.1"
                         /translation="MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRS
                         SVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGW
                         IFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSA
                         NNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA
                         LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNE
                         NGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGE
                         VFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADS
                         FVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRK
                         SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFEL
                         LHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV
                         RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRV
                         YSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIA
                         YTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLL
                         LQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP
                         SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIA
                         QYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSA
                         IGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEA
                         EVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYH
                         LMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQR
                         NFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDL
                         GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLI
                         AIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT"
         gene            25393..26220
                         /gene="ORF3a"
                         /label=ORF3a
         CDS             25393..26220
                         /codon_start=1
                         /gene="ORF3a"
                         /product="ORF3a protein"
                         /label=ORF3a
                         /protein_id="QHD43417.1"
                         /translation="MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGW
                         LIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAP
                         FLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSV
                         TSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTD
                         TGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL"
         gene            26245..26472
                         /gene="E"
                         /label=E
         CDS             26245..26472
                         /codon_start=1
                         /gene="E"
                         /product="envelope protein"
                         /label=E
                         /note="structural protein; E protein"
                         /protein_id="QHD43418.1"
                         /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCN
                         IVNVSLVKPSFYVYSRVKNLNSSRVPDLLV"
         gene            26523..27191
                         /gene="M"
                         /label=M
         CDS             26523..27191
                         /codon_start=1
                         /gene="M"
                         /product="membrane glycoprotein"
                         /label=M
                         /note="structural protein"
                         /protein_id="QHD43419.1"
                         /translation="MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRF
                         LYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFA
                         RTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKD
                         LPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
                         "
         gene            27202..27387
                         /gene="ORF6"
                         /label=ORF6
         CDS             27202..27387
                         /codon_start=1
                         /gene="ORF6"
                         /product="ORF6 protein"
                         /label=ORF6
                         /protein_id="QHD43420.1"
                         /translation="MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLT
                         ENKYSQLDEEQPMEID"
         gene            27394..27759
                         /gene="ORF7a"
                         /label=ORF7a
         CDS             27394..27759
                         /codon_start=1
                         /gene="ORF7a"
                         /product="ORF7a protein"
                         /label=ORF7a
                         /protein_id="QHD43421.1"
                         /translation="MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSP
                         FHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIV
                         AAIVFITLCFTLKRKTE"
         gene            27894..28259
                         /gene="ORF8"
                         /label=ORF8
         CDS             27894..28259
                         /codon_start=1
                         /gene="ORF8"
                         /product="ORF8 protein"
                         /label=ORF8
                         /protein_id="QHD43422.1"
                         /translation="MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKW
                         YIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSF
                         YEDFLEYHDVRVVLDFI"
         gene            28274..29533
                         /gene="N"
                         /label=N
         CDS             28274..29533
                         /codon_start=1
                         /gene="N"
                         /product="nucleocapsid phosphoprotein"
                         /label=N
                         /note="structural protein"
                         /protein_id="QHD43423.2"
                         /translation="MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGL
                         PNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDL
                         SPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQ
                         GTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALL
                         LLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQ
                         TQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLD
                         DKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAAD
                         LDDFSKQLQQSMSSADSTQA"
         gene            29558..29674
                         /gene="ORF10"
                         /label=ORF10
         CDS             29558..29674
                         /codon_start=1
                         /gene="ORF10"
                         /product="ORF10 protein"
                         /label=ORF10
                         /protein_id="QHI42199.1"
                         /translation="MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT"
         3'UTR           29675..29903
    ORIGIN
            1 attaaaggtt tataccttcc caggtaacaa accaaccaac tttcgatctc ttgtagatct
           61 gttctctaaa cgaactttaa aatctgtgtg gctgtcactc ggctgcatgc ttagtgcact
          121 cacgcagtat aattaataac taattactgt cgttgacagg acacgagtaa ctcgtctatc
          181 ttctgcaggc tgcttacggt ttcgtccgtg ttgcagccga tcatcagcac atctaggttt
          241 cgtccgggtg tgaccgaaag gtaagatgga gagccttgtc cctggtttca acgagaaaac
          301 acacgtccaa ctcagtttgc ctgttttaca ggttcgcgac gtgctcgtac gtggctttgg
          361 agactccgtg gaggaggtct tatcagaggc acgtcaacat cttaaagatg gcacttgtgg
          421 cttagtagaa gttgaaaaag gcgttttgcc tcaacttgaa cagccctatg tgttcatcaa
          481 acgttcggat gctcgaactg cacctcatgg tcatgttatg gttgagctgg tagcagaact
          541 cgaaggcatt cagtacggtc gtagtggtga gacacttggt gtccttgtcc ctcatgtggg
          601 cgaaatacca gtggcttacc gcaaggttct tcttcgtaag aacggtaata aaggagctgg
          661 tggccatagt tacggcgccg atctaaagtc atttgactta ggcgacgagc ttggcactga
          721 tccttatgaa gattttcaag aaaactggaa cactaaacat agcagtggtg ttacccgtga
          781 actcatgcgt gagcttaacg gaggggcata cactcgctat gtcgataaca acttctgtgg
          841 ccctgatggc taccctcttg agtgcattaa agaccttcta gcacgtgctg gtaaagcttc
          901 atgcactttg tccgaacaac tggactttat tgacactaag aggggtgtat actgctgccg
          961 tgaacatgag catgaaattg cttggtacac ggaacgttct gaaaagagct atgaattgca
         1021 gacacctttt gaaattaaat tggcaaagaa atttgacacc ttcaatgggg aatgtccaaa
         1081 ttttgtattt cccttaaatt ccataatcaa gactattcaa ccaagggttg aaaagaaaaa
         1141 gcttgatggc tttatgggta gaattcgatc tgtctatcca gttgcgtcac caaatgaatg
         1201 caaccaaatg tgcctttcaa ctctcatgaa gtgtgatcat tgtggtgaaa cttcatggca
         1261 gacgggcgat tttgttaaag ccacttgcga attttgtggc actgagaatt tgactaaaga
         1321 aggtgccact acttgtggtt acttacccca aaatgctgtt gttaaaattt attgtccagc
         1381 atgtcacaat tcagaagtag gacctgagca tagtcttgcc gaataccata atgaatctgg
         1441 cttgaaaacc attcttcgta agggtggtcg cactattgcc tttggaggct gtgtgttctc
         1501 ttatgttggt tgccataaca agtgtgccta ttgggttcca cgtgctagcg ctaacatagg
         1561 ttgtaaccat acaggtgttg ttggagaagg ttccgaaggt cttaatgaca accttcttga
         1621 aatactccaa aaagagaaag tcaacatcaa tattgttggt gactttaaac ttaatgaaga
         1681 gatcgccatt attttggcat ctttttctgc ttccacaagt gcttttgtgg aaactgtgaa
         1741 aggtttggat tataaagcat tcaaacaaat tgttgaatcc tgtggtaatt ttaaagttac
         1801 aaaaggaaaa gctaaaaaag gtgcctggaa tattggtgaa cagaaatcaa tactgagtcc
         1861 tctttatgca tttgcatcag aggctgctcg tgttgtacga tcaattttct cccgcactct
         1921 tgaaactgct caaaattctg tgcgtgtttt acagaaggcc gctataacaa tactagatgg
         1981 aatttcacag tattcactga gactcattga tgctatgatg ttcacatctg atttggctac
         2041 taacaatcta gttgtaatgg cctacattac aggtggtgtt gttcagttga cttcgcagtg
         2101 gctaactaac atctttggca ctgtttatga aaaactcaaa cccgtccttg attggcttga
         2161 agagaagttt aaggaaggtg tagagtttct tagagacggt tgggaaattg ttaaatttat
         2221 ctcaacctgt gcttgtgaaa ttgtcggtgg acaaattgtc acctgtgcaa aggaaattaa
         2281 ggagagtgtt cagacattct ttaagcttgt aaataaattt ttggctttgt gtgctgactc
         2341 tatcattatt ggtggagcta aacttaaagc cttgaattta ggtgaaacat ttgtcacgca
         2401 ctcaaaggga ttgtacagaa agtgtgttaa atccagagaa gaaactggcc tactcatgcc
         2461 tctaaaagcc ccaaaagaaa ttatcttctt agagggagaa acacttccca cagaagtgtt
         2521 aacagaggaa gttgtcttga aaactggtga tttacaacca ttagaacaac ctactagtga
         2581 agctgttgaa gctccattgg ttggtacacc agtttgtatt aacgggctta tgttgctcga
         2641 aatcaaagac acagaaaagt actgtgccct tgcacctaat atgatggtaa caaacaatac
         2701 cttcacactc aaaggcggtg caccaacaaa ggttactttt ggtgatgaca ctgtgataga
         2761 agtgcaaggt tacaagagtg tgaatatcac ttttgaactt gatgaaagga ttgataaagt
         2821 acttaatgag aagtgctctg cctatacagt tgaactcggt acagaagtaa atgagttcgc
         2881 ctgtgttgtg gcagatgctg tcataaaaac tttgcaacca gtatctgaat tacttacacc
         2941 actgggcatt gatttagatg agtggagtat ggctacatac tacttatttg atgagtctgg
         3001 tgagtttaaa ttggcttcac atatgtattg ttctttctac cctccagatg aggatgaaga
         3061 agaaggtgat tgtgaagaag aagagtttga gccatcaact caatatgagt atggtactga
         3121 agatgattac caaggtaaac ctttggaatt tggtgccact tctgctgctc ttcaacctga
         3181 agaagagcaa gaagaagatt ggttagatga tgatagtcaa caaactgttg gtcaacaaga
         3241 cggcagtgag gacaatcaga caactactat tcaaacaatt gttgaggttc aacctcaatt
         3301 agagatggaa cttacaccag ttgttcagac tattgaagtg aatagtttta gtggttattt
         3361 aaaacttact gacaatgtat acattaaaaa tgcagacatt gtggaagaag ctaaaaaggt
         3421 aaaaccaaca gtggttgtta atgcagccaa tgtttacctt aaacatggag gaggtgttgc
         3481 aggagcctta aataaggcta ctaacaatgc catgcaagtt gaatctgatg attacatagc
         3541 tactaatgga ccacttaaag tgggtggtag ttgtgtttta agcggacaca atcttgctaa
         3601 acactgtctt catgttgtcg gcccaaatgt taacaaaggt gaagacattc aacttcttaa
         3661 gagtgcttat gaaaatttta atcagcacga agttctactt gcaccattat tatcagctgg
         3721 tatttttggt gctgacccta tacattcttt aagagtttgt gtagatactg ttcgcacaaa
         3781 tgtctactta gctgtctttg ataaaaatct ctatgacaaa cttgtttcaa gctttttgga
         3841 aatgaagagt gaaaagcaag ttgaacaaaa gatcgctgag attcctaaag aggaagttaa
         3901 gccatttata actgaaagta aaccttcagt tgaacagaga aaacaagatg ataagaaaat
         3961 caaagcttgt gttgaagaag ttacaacaac tctggaagaa actaagttcc tcacagaaaa
         4021 cttgttactt tatattgaca ttaatggcaa tcttcatcca gattctgcca ctcttgttag
         4081 tgacattgac atcactttct taaagaaaga tgctccatat atagtgggtg atgttgttca
         4141 agagggtgtt ttaactgctg tggttatacc tactaaaaag gctggtggca ctactgaaat
         4201 gctagcgaaa gctttgagaa aagtgccaac agacaattat ataaccactt acccgggtca
         4261 gggtttaaat ggttacactg tagaggaggc aaagacagtg cttaaaaagt gtaaaagtgc
         4321 cttttacatt ctaccatcta ttatctctaa tgagaagcaa gaaattcttg gaactgtttc
         4381 ttggaatttg cgagaaatgc ttgcacatgc agaagaaaca cgcaaattaa tgcctgtctg
         4441 tgtggaaact aaagccatag tttcaactat acagcgtaaa tataagggta ttaaaataca
         4501 agagggtgtg gttgattatg gtgctagatt ttacttttac accagtaaaa caactgtagc
         4561 gtcacttatc aacacactta acgatctaaa tgaaactctt gttacaatgc cacttggcta
         4621 tgtaacacat ggcttaaatt tggaagaagc tgctcggtat atgagatctc tcaaagtgcc
         4681 agctacagtt tctgtttctt cacctgatgc tgttacagcg tataatggtt atcttacttc
         4741 ttcttctaaa acacctgaag aacattttat tgaaaccatc tcacttgctg gttcctataa
         4801 agattggtcc tattctggac aatctacaca actaggtata gaatttctta agagaggtga
         4861 taaaagtgta tattacacta gtaatcctac cacattccac ctagatggtg aagttatcac
         4921 ctttgacaat cttaagacac ttctttcttt gagagaagtg aggactatta aggtgtttac
         4981 aacagtagac aacattaacc tccacacgca agttgtggac atgtcaatga catatggaca
         5041 acagtttggt ccaacttatt tggatggagc tgatgttact aaaataaaac ctcataattc
         5101 acatgaaggt aaaacatttt atgttttacc taatgatgac actctacgtg ttgaggcttt
         5161 tgagtactac cacacaactg atcctagttt tctgggtagg tacatgtcag cattaaatca
         5221 cactaaaaag tggaaatacc cacaagttaa tggtttaact tctattaaat gggcagataa
         5281 caactgttat cttgccactg cattgttaac actccaacaa atagagttga agtttaatcc
         5341 acctgctcta caagatgctt attacagagc aagggctggt gaagctgcta acttttgtgc
         5401 acttatctta gcctactgta ataagacagt aggtgagtta ggtgatgtta gagaaacaat
         5461 gagttacttg tttcaacatg ccaatttaga ttcttgcaaa agagtcttga acgtggtgtg
         5521 taaaacttgt ggacaacagc agacaaccct taagggtgta gaagctgtta tgtacatggg
         5581 cacactttct tatgaacaat ttaagaaagg tgttcagata ccttgtacgt gtggtaaaca
         5641 agctacaaaa tatctagtac aacaggagtc accttttgtt atgatgtcag caccacctgc
         5701 tcagtatgaa cttaagcatg gtacatttac ttgtgctagt gagtacactg gtaattacca
         5761 gtgtggtcac tataaacata taacttctaa agaaactttg tattgcatag acggtgcttt
         5821 acttacaaag tcctcagaat acaaaggtcc tattacggat gttttctaca aagaaaacag
         5881 ttacacaaca accataaaac cagttactta taaattggat ggtgttgttt gtacagaaat
         5941 tgaccctaag ttggacaatt attataagaa agacaattct tatttcacag agcaaccaat
         6001 tgatcttgta ccaaaccaac catatccaaa cgcaagcttc gataatttta agtttgtatg
         6061 tgataatatc aaatttgctg atgatttaaa ccagttaact ggttataaga aacctgcttc
         6121 aagagagctt aaagttacat ttttccctga cttaaatggt gatgtggtgg ctattgatta
         6181 taaacactac acaccctctt ttaagaaagg agctaaattg ttacataaac ctattgtttg
         6241 gcatgttaac aatgcaacta ataaagccac gtataaacca aatacctggt gtatacgttg
         6301 tctttggagc acaaaaccag ttgaaacatc aaattcgttt gatgtactga agtcagagga
         6361 cgcgcaggga atggataatc ttgcctgcga agatctaaaa ccagtctctg aagaagtagt
         6421 ggaaaatcct accatacaga aagacgttct tgagtgtaat gtgaaaacta ccgaagttgt
         6481 aggagacatt atacttaaac cagcaaataa tagtttaaaa attacagaag aggttggcca
         6541 cacagatcta atggctgctt atgtagacaa ttctagtctt actattaaga aacctaatga
         6601 attatctaga gtattaggtt tgaaaaccct tgctactcat ggtttagctg ctgttaatag
         6661 tgtcccttgg gatactatag ctaattatgc taagcctttt cttaacaaag ttgttagtac
         6721 aactactaac atagttacac ggtgtttaaa ccgtgtttgt actaattata tgccttattt
         6781 ctttacttta ttgctacaat tgtgtacttt tactagaagt acaaattcta gaattaaagc
         6841 atctatgccg actactatag caaagaatac tgttaagagt gtcggtaaat tttgtctaga
         6901 ggcttcattt aattatttga agtcacctaa tttttctaaa ctgataaata ttataatttg
         6961 gtttttacta ttaagtgttt gcctaggttc tttaatctac tcaaccgctg ctttaggtgt
         7021 tttaatgtct aatttaggca tgccttctta ctgtactggt tacagagaag gctatttgaa
         7081 ctctactaat gtcactattg caacctactg tactggttct ataccttgta gtgtttgtct
         7141 tagtggttta gattctttag acacctatcc ttctttagaa actatacaaa ttaccatttc
         7201 atcttttaaa tgggatttaa ctgcttttgg cttagttgca gagtggtttt tggcatatat
         7261 tcttttcact aggtttttct atgtacttgg attggctgca atcatgcaat tgtttttcag
         7321 ctattttgca gtacatttta ttagtaattc ttggcttatg tggttaataa ttaatcttgt
         7381 acaaatggcc ccgatttcag ctatggttag aatgtacatc ttctttgcat cattttatta
         7441 tgtatggaaa agttatgtgc atgttgtaga cggttgtaat tcatcaactt gtatgatgtg
         7501 ttacaaacgt aatagagcaa caagagtcga atgtacaact attgttaatg gtgttagaag
         7561 gtccttttat gtctatgcta atggaggtaa aggcttttgc aaactacaca attggaattg
         7621 tgttaattgt gatacattct gtgctggtag tacatttatt agtgatgaag ttgcgagaga
         7681 cttgtcacta cagtttaaaa gaccaataaa tcctactgac cagtcttctt acatcgttga
         7741 tagtgttaca gtgaagaatg gttccatcca tctttacttt gataaagctg gtcaaaagac
         7801 ttatgaaaga cattctctct ctcattttgt taacttagac aacctgagag ctaataacac
         7861 taaaggttca ttgcctatta atgttatagt ttttgatggt aaatcaaaat gtgaagaatc
         7921 atctgcaaaa tcagcgtctg tttactacag tcagcttatg tgtcaaccta tactgttact
         7981 agatcaggca ttagtgtctg atgttggtga tagtgcggaa gttgcagtta aaatgtttga
         8041 tgcttacgtt aatacgtttt catcaacttt taacgtacca atggaaaaac tcaaaacact
         8101 agttgcaact gcagaagctg aacttgcaaa gaatgtgtcc ttagacaatg tcttatctac
         8161 ttttatttca gcagctcggc aagggtttgt tgattcagat gtagaaacta aagatgttgt
         8221 tgaatgtctt aaattgtcac atcaatctga catagaagtt actggcgata gttgtaataa
         8281 ctatatgctc acctataaca aagttgaaaa catgacaccc cgtgaccttg gtgcttgtat
         8341 tgactgtagt gcgcgtcata ttaatgcgca ggtagcaaaa agtcacaaca ttgctttgat
         8401 atggaacgtt aaagatttca tgtcattgtc tgaacaacta cgaaaacaaa tacgtagtgc
         8461 tgctaaaaag aataacttac cttttaagtt gacatgtgca actactagac aagttgttaa
         8521 tgttgtaaca acaaagatag cacttaaggg tggtaaaatt gttaataatt ggttgaagca
         8581 gttaattaaa gttacacttg tgttcctttt tgttgctgct attttctatt taataacacc
         8641 tgttcatgtc atgtctaaac atactgactt ttcaagtgaa atcataggat acaaggctat
         8701 tgatggtggt gtcactcgtg acatagcatc tacagatact tgttttgcta acaaacatgc
         8761 tgattttgac acatggttta gccagcgtgg tggtagttat actaatgaca aagcttgccc
         8821 attgattgct gcagtcataa caagagaagt gggttttgtc gtgcctggtt tgcctggcac
         8881 gatattacgc acaactaatg gtgacttttt gcatttctta cctagagttt ttagtgcagt
         8941 tggtaacatc tgttacacac catcaaaact tatagagtac actgactttg caacatcagc
         9001 ttgtgttttg gctgctgaat gtacaatttt taaagatgct tctggtaagc cagtaccata
         9061 ttgttatgat accaatgtac tagaaggttc tgttgcttat gaaagtttac gccctgacac
         9121 acgttatgtg ctcatggatg gctctattat tcaatttcct aacacctacc ttgaaggttc
         9181 tgttagagtg gtaacaactt ttgattctga gtactgtagg cacggcactt gtgaaagatc
         9241 agaagctggt gtttgtgtat ctactagtgg tagatgggta cttaacaatg attattacag
         9301 atctttacca ggagttttct gtggtgtaga tgctgtaaat ttacttacta atatgtttac
         9361 accactaatt caacctattg gtgctttgga catatcagca tctatagtag ctggtggtat
         9421 tgtagctatc gtagtaacat gccttgccta ctattttatg aggtttagaa gagcttttgg
         9481 tgaatacagt catgtagttg cctttaatac tttactattc cttatgtcat tcactgtact
         9541 ctgtttaaca ccagtttact cattcttacc tggtgtttat tctgttattt acttgtactt
         9601 gacattttat cttactaatg atgtttcttt tttagcacat attcagtgga tggttatgtt
         9661 cacaccttta gtacctttct ggataacaat tgcttatatc atttgtattt ccacaaagca
         9721 tttctattgg ttctttagta attacctaaa gagacgtgta gtctttaatg gtgtttcctt
         9781 tagtactttt gaagaagctg cgctgtgcac ctttttgtta aataaagaaa tgtatctaaa
         9841 gttgcgtagt gatgtgctat tacctcttac gcaatataat agatacttag ctctttataa
         9901 taagtacaag tattttagtg gagcaatgga tacaactagc tacagagaag ctgcttgttg
         9961 tcatctcgca aaggctctca atgacttcag taactcaggt tctgatgttc tttaccaacc
        10021 accacaaacc tctatcacct cagctgtttt gcagagtggt tttagaaaaa tggcattccc
        10081 atctggtaaa gttgagggtt gtatggtaca agtaacttgt ggtacaacta cacttaacgg
        10141 tctttggctt gatgacgtag tttactgtcc aagacatgtg atctgcacct ctgaagacat
        10201 gcttaaccct aattatgaag atttactcat tcgtaagtct aatcataatt tcttggtaca
        10261 ggctggtaat gttcaactca gggttattgg acattctatg caaaattgtg tacttaagct
        10321 taaggttgat acagccaatc ctaagacacc taagtataag tttgttcgca ttcaaccagg
        10381 acagactttt tcagtgttag cttgttacaa tggttcacca tctggtgttt accaatgtgc
        10441 tatgaggccc aatttcacta ttaagggttc attccttaat ggttcatgtg gtagtgttgg
        10501 ttttaacata gattatgact gtgtctcttt ttgttacatg caccatatgg aattaccaac
        10561 tggagttcat gctggcacag acttagaagg taacttttat ggaccttttg ttgacaggca
        10621 aacagcacaa gcagctggta cggacacaac tattacagtt aatgttttag cttggttgta
        10681 cgctgctgtt ataaatggag acaggtggtt tctcaatcga tttaccacaa ctcttaatga
        10741 ctttaacctt gtggctatga agtacaatta tgaacctcta acacaagacc atgttgacat
        10801 actaggacct ctttctgctc aaactggaat tgccgtttta gatatgtgtg cttcattaaa
        10861 agaattactg caaaatggta tgaatggacg taccatattg ggtagtgctt tattagaaga
        10921 tgaatttaca ccttttgatg ttgttagaca atgctcaggt gttactttcc aaagtgcagt
        10981 gaaaagaaca atcaagggta cacaccactg gttgttactc acaattttga cttcactttt
        11041 agttttagtc cagagtactc aatggtcttt gttctttttt ttgtatgaaa atgccttttt
        11101 accttttgct atgggtatta ttgctatgtc tgcttttgca atgatgtttg tcaaacataa
        11161 gcatgcattt ctctgtttgt ttttgttacc ttctcttgcc actgtagctt attttaatat
        11221 ggtctatatg cctgctagtt gggtgatgcg tattatgaca tggttggata tggttgatac
        11281 tagtttgtct ggttttaagc taaaagactg tgttatgtat gcatcagctg tagtgttact
        11341 aatccttatg acagcaagaa ctgtgtatga tgatggtgct aggagagtgt ggacacttat
        11401 gaatgtcttg acactcgttt ataaagttta ttatggtaat gctttagatc aagccatttc
        11461 catgtgggct cttataatct ctgttacttc taactactca ggtgtagtta caactgtcat
        11521 gtttttggcc agaggtattg tttttatgtg tgttgagtat tgccctattt tcttcataac
        11581 tggtaataca cttcagtgta taatgctagt ttattgtttc ttaggctatt tttgtacttg
        11641 ttactttggc ctcttttgtt tactcaaccg ctactttaga ctgactcttg gtgtttatga
        11701 ttacttagtt tctacacagg agtttagata tatgaattca cagggactac tcccacccaa
        11761 gaatagcata gatgccttca aactcaacat taaattgttg ggtgttggtg gcaaaccttg
        11821 tatcaaagta gccactgtac agtctaaaat gtcagatgta aagtgcacat cagtagtctt
        11881 actctcagtt ttgcaacaac tcagagtaga atcatcatct aaattgtggg ctcaatgtgt
        11941 ccagttacac aatgacattc tcttagctaa agatactact gaagcctttg aaaaaatggt
        12001 ttcactactt tctgttttgc tttccatgca gggtgctgta gacataaaca agctttgtga
        12061 agaaatgctg gacaacaggg caaccttaca agctatagcc tcagagttta gttcccttcc
        12121 atcatatgca gcttttgcta ctgctcaaga agcttatgag caggctgttg ctaatggtga
        12181 ttctgaagtt gttcttaaaa agttgaagaa gtctttgaat gtggctaaat ctgaatttga
        12241 ccgtgatgca gccatgcaac gtaagttgga aaagatggct gatcaagcta tgacccaaat
        12301 gtataaacag gctagatctg aggacaagag ggcaaaagtt actagtgcta tgcagacaat
        12361 gcttttcact atgcttagaa agttggataa tgatgcactc aacaacatta tcaacaatgc
        12421 aagagatggt tgtgttccct tgaacataat acctcttaca acagcagcca aactaatggt
        12481 tgtcatacca gactataaca catataaaaa tacgtgtgat ggtacaacat ttacttatgc
        12541 atcagcattg tgggaaatcc aacaggttgt agatgcagat agtaaaattg ttcaacttag
        12601 tgaaattagt atggacaatt cacctaattt agcatggcct cttattgtaa cagctttaag
        12661 ggccaattct gctgtcaaat tacagaataa tgagcttagt cctgttgcac tacgacagat
        12721 gtcttgtgct gccggtacta cacaaactgc ttgcactgat gacaatgcgt tagcttacta
        12781 caacacaaca aagggaggta ggtttgtact tgcactgtta tccgatttac aggatttgaa
        12841 atgggctaga ttccctaaga gtgatggaac tggtactatc tatacagaac tggaaccacc
        12901 ttgtaggttt gttacagaca cacctaaagg tcctaaagtg aagtatttat actttattaa
        12961 aggattaaac aacctaaata gaggtatggt acttggtagt ttagctgcca cagtacgtct
        13021 acaagctggt aatgcaacag aagtgcctgc caattcaact gtattatctt tctgtgcttt
        13081 tgctgtagat gctgctaaag cttacaaaga ttatctagct agtgggggac aaccaatcac
        13141 taattgtgtt aagatgttgt gtacacacac tggtactggt caggcaataa cagttacacc
        13201 ggaagccaat atggatcaag aatcctttgg tggtgcatcg tgttgtctgt actgccgttg
        13261 ccacatagat catccaaatc ctaaaggatt ttgtgactta aaaggtaagt atgtacaaat
        13321 acctacaact tgtgctaatg accctgtggg ttttacactt aaaaacacag tctgtaccgt
        13381 ctgcggtatg tggaaaggtt atggctgtag ttgtgatcaa ctccgcgaac ccatgcttca
        13441 gtcagctgat gcacaatcgt ttttaaacgg gtttgcggtg taagtgcagc ccgtcttaca
        13501 ccgtgcggca caggcactag tactgatgtc gtatacaggg cttttgacat ctacaatgat
        13561 aaagtagctg gttttgctaa attcctaaaa actaattgtt gtcgcttcca agaaaaggac
        13621 gaagatgaca atttaattga ttcttacttt gtagttaaga gacacacttt ctctaactac
        13681 caacatgaag aaacaattta taatttactt aaggattgtc cagctgttgc taaacatgac
        13741 ttctttaagt ttagaataga cggtgacatg gtaccacata tatcacgtca acgtcttact
        13801 aaatacacaa tggcagacct cgtctatgct ttaaggcatt ttgatgaagg taattgtgac
        13861 acattaaaag aaatacttgt cacatacaat tgttgtgatg atgattattt caataaaaag
        13921 gactggtatg attttgtaga aaacccagat atattacgcg tatacgccaa cttaggtgaa
        13981 cgtgtacgcc aagctttgtt aaaaacagta caattctgtg atgccatgcg aaatgctggt
        14041 attgttggtg tactgacatt agataatcaa gatctcaatg gtaactggta tgatttcggt
        14101 gatttcatac aaaccacgcc aggtagtgga gttcctgttg tagattctta ttattcattg
        14161 ttaatgccta tattaacctt gaccagggct ttaactgcag agtcacatgt tgacactgac
        14221 ttaacaaagc cttacattaa gtgggatttg ttaaaatatg acttcacgga agagaggtta
        14281 aaactctttg accgttattt taaatattgg gatcagacat accacccaaa ttgtgttaac
        14341 tgtttggatg acagatgcat tctgcattgt gcaaacttta atgttttatt ctctacagtg
        14401 ttcccaccta caagttttgg accactagtg agaaaaatat ttgttgatgg tgttccattt
        14461 gtagtttcaa ctggatacca cttcagagag ctaggtgttg tacataatca ggatgtaaac
        14521 ttacatagct ctagacttag ttttaaggaa ttacttgtgt atgctgctga ccctgctatg
        14581 cacgctgctt ctggtaatct attactagat aaacgcacta cgtgcttttc agtagctgca
        14641 cttactaaca atgttgcttt tcaaactgtc aaacccggta attttaacaa agacttctat
        14701 gactttgctg tgtctaaggg tttctttaag gaaggaagtt ctgttgaatt aaaacacttc
        14761 ttctttgctc aggatggtaa tgctgctatc agcgattatg actactatcg ttataatcta
        14821 ccaacaatgt gtgatatcag acaactacta tttgtagttg aagttgttga taagtacttt
        14881 gattgttacg atggtggctg tattaatgct aaccaagtca tcgtcaacaa cctagacaaa
        14941 tcagctggtt ttccatttaa taaatggggt aaggctagac tttattatga ttcaatgagt
        15001 tatgaggatc aagatgcact tttcgcatat acaaaacgta atgtcatccc tactataact
        15061 caaatgaatc ttaagtatgc cattagtgca aagaatagag ctcgcaccgt agctggtgtc
        15121 tctatctgta gtactatgac caatagacag tttcatcaaa aattattgaa atcaatagcc
        15181 gccactagag gagctactgt agtaattgga acaagcaaat tctatggtgg ttggcacaac
        15241 atgttaaaaa ctgtttatag tgatgtagaa aaccctcacc ttatgggttg ggattatcct
        15301 aaatgtgata gagccatgcc taacatgctt agaattatgg cctcacttgt tcttgctcgc
        15361 aaacatacaa cgtgttgtag cttgtcacac cgtttctata gattagctaa tgagtgtgct
        15421 caagtattga gtgaaatggt catgtgtggc ggttcactat atgttaaacc aggtggaacc
        15481 tcatcaggag atgccacaac tgcttatgct aatagtgttt ttaacatttg tcaagctgtc
        15541 acggccaatg ttaatgcact tttatctact gatggtaaca aaattgccga taagtatgtc
        15601 cgcaatttac aacacagact ttatgagtgt ctctatagaa atagagatgt tgacacagac
        15661 tttgtgaatg agttttacgc atatttgcgt aaacatttct caatgatgat actctctgac
        15721 gatgctgttg tgtgtttcaa tagcacttat gcatctcaag gtctagtggc tagcataaag
        15781 aactttaagt cagttcttta ttatcaaaac aatgttttta tgtctgaagc aaaatgttgg
        15841 actgagactg accttactaa aggacctcat gaattttgct ctcaacatac aatgctagtt
        15901 aaacagggtg atgattatgt gtaccttcct tacccagatc catcaagaat cctaggggcc
        15961 ggctgttttg tagatgatat cgtaaaaaca gatggtacac ttatgattga acggttcgtg
        16021 tctttagcta tagatgctta cccacttact aaacatccta atcaggagta tgctgatgtc
        16081 tttcatttgt acttacaata cataagaaag ctacatgatg agttaacagg acacatgtta
        16141 gacatgtatt ctgttatgct tactaatgat aacacttcaa ggtattggga acctgagttt
        16201 tatgaggcta tgtacacacc gcatacagtc ttacaggctg ttggggcttg tgttctttgc
        16261 aattcacaga cttcattaag atgtggtgct tgcatacgta gaccattctt atgttgtaaa
        16321 tgctgttacg accatgtcat atcaacatca cataaattag tcttgtctgt taatccgtat
        16381 gtttgcaatg ctccaggttg tgatgtcaca gatgtgactc aactttactt aggaggtatg
        16441 agctattatt gtaaatcaca taaaccaccc attagttttc cattgtgtgc taatggacaa
        16501 gtttttggtt tatataaaaa tacatgtgtt ggtagcgata atgttactga ctttaatgca
        16561 attgcaacat gtgactggac aaatgctggt gattacattt tagctaacac ctgtactgaa
        16621 agactcaagc tttttgcagc agaaacgctc aaagctactg aggagacatt taaactgtct
        16681 tatggtattg ctactgtacg tgaagtgctg tctgacagag aattacatct ttcatgggaa
        16741 gttggtaaac ctagaccacc acttaaccga aattatgtct ttactggtta tcgtgtaact
        16801 aaaaacagta aagtacaaat aggagagtac acctttgaaa aaggtgacta tggtgatgct
        16861 gttgtttacc gaggtacaac aacttacaaa ttaaatgttg gtgattattt tgtgctgaca
        16921 tcacatacag taatgccatt aagtgcacct acactagtgc cacaagagca ctatgttaga
        16981 attactggct tatacccaac actcaatatc tcagatgagt tttctagcaa tgttgcaaat
        17041 tatcaaaagg ttggtatgca aaagtattct acactccagg gaccacctgg tactggtaag
        17101 agtcattttg ctattggcct agctctctac tacccttctg ctcgcatagt gtatacagct
        17161 tgctctcatg ccgctgttga tgcactatgt gagaaggcat taaaatattt gcctatagat
        17221 aaatgtagta gaattatacc tgcacgtgct cgtgtagagt gttttgataa attcaaagtg
        17281 aattcaacat tagaacagta tgtcttttgt actgtaaatg cattgcctga gacgacagca
        17341 gatatagttg tctttgatga aatttcaatg gccacaaatt atgatttgag tgttgtcaat
        17401 gccagattac gtgctaagca ctatgtgtac attggcgacc ctgctcaatt acctgcacca
        17461 cgcacattgc taactaaggg cacactagaa ccagaatatt tcaattcagt gtgtagactt
        17521 atgaaaacta taggtccaga catgttcctc ggaacttgtc ggcgttgtcc tgctgaaatt
        17581 gttgacactg tgagtgcttt ggtttatgat aataagctta aagcacataa agacaaatca
        17641 gctcaatgct ttaaaatgtt ttataagggt gttatcacgc atgatgtttc atctgcaatt
        17701 aacaggccac aaataggcgt ggtaagagaa ttccttacac gtaaccctgc ttggagaaaa
        17761 gctgtcttta tttcacctta taattcacag aatgctgtag cctcaaagat tttgggacta
        17821 ccaactcaaa ctgttgattc atcacagggc tcagaatatg actatgtcat attcactcaa
        17881 accactgaaa cagctcactc ttgtaatgta aacagattta atgttgctat taccagagca
        17941 aaagtaggca tactttgcat aatgtctgat agagaccttt atgacaagtt gcaatttaca
        18001 agtcttgaaa ttccacgtag gaatgtggca actttacaag ctgaaaatgt aacaggactc
        18061 tttaaagatt gtagtaaggt aatcactggg ttacatccta cacaggcacc tacacacctc
        18121 agtgttgaca ctaaattcaa aactgaaggt ttatgtgttg acatacctgg catacctaag
        18181 gacatgacct atagaagact catctctatg atgggtttta aaatgaatta tcaagttaat
        18241 ggttacccta acatgtttat cacccgcgaa gaagctataa gacatgtacg tgcatggatt
        18301 ggcttcgatg tcgaggggtg tcatgctact agagaagctg ttggtaccaa tttaccttta
        18361 cagctaggtt tttctacagg tgttaaccta gttgctgtac ctacaggtta tgttgataca
        18421 cctaataata cagatttttc cagagttagt gctaaaccac cgcctggaga tcaatttaaa
        18481 cacctcatac cacttatgta caaaggactt ccttggaatg tagtgcgtat aaagattgta
        18541 caaatgttaa gtgacacact taaaaatctc tctgacagag tcgtatttgt cttatgggca
        18601 catggctttg agttgacatc tatgaagtat tttgtgaaaa taggacctga gcgcacctgt
        18661 tgtctatgtg atagacgtgc cacatgcttt tccactgctt cagacactta tgcctgttgg
        18721 catcattcta ttggatttga ttacgtctat aatccgttta tgattgatgt tcaacaatgg
        18781 ggttttacag gtaacctaca aagcaaccat gatctgtatt gtcaagtcca tggtaatgca
        18841 catgtagcta gttgtgatgc aatcatgact aggtgtctag ctgtccacga gtgctttgtt
        18901 aagcgtgttg actggactat tgaatatcct ataattggtg atgaactgaa gattaatgcg
        18961 gcttgtagaa aggttcaaca catggttgtt aaagctgcat tattagcaga caaattccca
        19021 gttcttcacg acattggtaa ccctaaagct attaagtgtg tacctcaagc tgatgtagaa
        19081 tggaagttct atgatgcaca gccttgtagt gacaaagctt ataaaataga agaattattc
        19141 tattcttatg ccacacattc tgacaaattc acagatggtg tatgcctatt ttggaattgc
        19201 aatgtcgata gatatcctgc taattccatt gtttgtagat ttgacactag agtgctatct
        19261 aaccttaact tgcctggttg tgatggtggc agtttgtatg taaataaaca tgcattccac
        19321 acaccagctt ttgataaaag tgcttttgtt aatttaaaac aattaccatt tttctattac
        19381 tctgacagtc catgtgagtc tcatggaaaa caagtagtgt cagatataga ttatgtacca
        19441 ctaaagtctg ctacgtgtat aacacgttgc aatttaggtg gtgctgtctg tagacatcat
        19501 gctaatgagt acagattgta tctcgatgct tataacatga tgatctcagc tggctttagc
        19561 ttgtgggttt acaaacaatt tgatacttat aacctctgga acacttttac aagacttcag
        19621 agtttagaaa atgtggcttt taatgttgta aataagggac actttgatgg acaacagggt
        19681 gaagtaccag tttctatcat taataacact gtttacacaa aagttgatgg tgttgatgta
        19741 gaattgtttg aaaataaaac aacattacct gttaatgtag catttgagct ttgggctaag
        19801 cgcaacatta aaccagtacc agaggtgaaa atactcaata atttgggtgt ggacattgct
        19861 gctaatactg tgatctggga ctacaaaaga gatgctccag cacatatatc tactattggt
        19921 gtttgttcta tgactgacat agccaagaaa ccaactgaaa cgatttgtgc accactcact
        19981 gtcttttttg atggtagagt tgatggtcaa gtagacttat ttagaaatgc ccgtaatggt
        20041 gttcttatta cagaaggtag tgttaaaggt ttacaaccat ctgtaggtcc caaacaagct
        20101 agtcttaatg gagtcacatt aattggagaa gccgtaaaaa cacagttcaa ttattataag
        20161 aaagttgatg gtgttgtcca acaattacct gaaacttact ttactcagag tagaaattta
        20221 caagaattta aacccaggag tcaaatggaa attgatttct tagaattagc tatggatgaa
        20281 ttcattgaac ggtataaatt agaaggctat gccttcgaac atatcgttta tggagatttt
        20341 agtcatagtc agttaggtgg tttacatcta ctgattggac tagctaaacg ttttaaggaa
        20401 tcaccttttg aattagaaga ttttattcct atggacagta cagttaaaaa ctatttcata
        20461 acagatgcgc aaacaggttc atctaagtgt gtgtgttctg ttattgattt attacttgat
        20521 gattttgttg aaataataaa atcccaagat ttatctgtag tttctaaggt tgtcaaagtg
        20581 actattgact atacagaaat ttcatttatg ctttggtgta aagatggcca tgtagaaaca
        20641 ttttacccaa aattacaatc tagtcaagcg tggcaaccgg gtgttgctat gcctaatctt
        20701 tacaaaatgc aaagaatgct attagaaaag tgtgaccttc aaaattatgg tgatagtgca
        20761 acattaccta aaggcataat gatgaatgtc gcaaaatata ctcaactgtg tcaatattta
        20821 aacacattaa cattagctgt accctataat atgagagtta tacattttgg tgctggttct
        20881 gataaaggag ttgcaccagg tacagctgtt ttaagacagt ggttgcctac gggtacgctg
        20941 cttgtcgatt cagatcttaa tgactttgtc tctgatgcag attcaacttt gattggtgat
        21001 tgtgcaactg tacatacagc taataaatgg gatctcatta ttagtgatat gtacgaccct
        21061 aagactaaaa atgttacaaa agaaaatgac tctaaagagg gttttttcac ttacatttgt
        21121 gggtttatac aacaaaagct agctcttgga ggttccgtgg ctataaagat aacagaacat
        21181 tcttggaatg ctgatcttta taagctcatg ggacacttcg catggtggac agcctttgtt
        21241 actaatgtga atgcgtcatc atctgaagca tttttaattg gatgtaatta tcttggcaaa
        21301 ccacgcgaac aaatagatgg ttatgtcatg catgcaaatt acatattttg gaggaataca
        21361 aatccaattc agttgtcttc ctattcttta tttgacatga gtaaatttcc ccttaaatta
        21421 aggggtactg ctgttatgtc tttaaaagaa ggtcaaatca atgatatgat tttatctctt
        21481 cttagtaaag gtagacttat aattagagaa aacaacagag ttgttatttc tagtgatgtt
        21541 cttgttaaca actaaacgaa caatgtttgt ttttcttgtt ttattgccac tagtctctag
        21601 tcagtgtgtt aatcttacaa ccagaactca attaccccct gcatacacta attctttcac
        21661 acgtggtgtt tattaccctg acaaagtttt cagatcctca gttttacatt caactcagga
        21721 cttgttctta cctttctttt ccaatgttac ttggttccat gctatacatg tctctgggac
        21781 caatggtact aagaggtttg ataaccctgt cctaccattt aatgatggtg tttattttgc
        21841 ttccactgag aagtctaaca taataagagg ctggattttt ggtactactt tagattcgaa
        21901 gacccagtcc ctacttattg ttaataacgc tactaatgtt gttattaaag tctgtgaatt
        21961 tcaattttgt aatgatccat ttttgggtgt ttattaccac aaaaacaaca aaagttggat
        22021 ggaaagtgag ttcagagttt attctagtgc gaataattgc acttttgaat atgtctctca
        22081 gccttttctt atggaccttg aaggaaaaca gggtaatttc aaaaatctta gggaatttgt
        22141 gtttaagaat attgatggtt attttaaaat atattctaag cacacgccta ttaatttagt
        22201 gcgtgatctc cctcagggtt tttcggcttt agaaccattg gtagatttgc caataggtat
        22261 taacatcact aggtttcaaa ctttacttgc tttacataga agttatttga ctcctggtga
        22321 ttcttcttca ggttggacag ctggtgctgc agcttattat gtgggttatc ttcaacctag
        22381 gacttttcta ttaaaatata atgaaaatgg aaccattaca gatgctgtag actgtgcact
        22441 tgaccctctc tcagaaacaa agtgtacgtt gaaatccttc actgtagaaa aaggaatcta
        22501 tcaaacttct aactttagag tccaaccaac agaatctatt gttagatttc ctaatattac
        22561 aaacttgtgc ccttttggtg aagtttttaa cgccaccaga tttgcatctg tttatgcttg
        22621 gaacaggaag agaatcagca actgtgttgc tgattattct gtcctatata attccgcatc
        22681 attttccact tttaagtgtt atggagtgtc tcctactaaa ttaaatgatc tctgctttac
        22741 taatgtctat gcagattcat ttgtaattag aggtgatgaa gtcagacaaa tcgctccagg
        22801 gcaaactgga aagattgctg attataatta taaattacca gatgatttta caggctgcgt
        22861 tatagcttgg aattctaaca atcttgattc taaggttggt ggtaattata attacctgta
        22921 tagattgttt aggaagtcta atctcaaacc ttttgagaga gatatttcaa ctgaaatcta
        22981 tcaggccggt agcacacctt gtaatggtgt tgaaggtttt aattgttact ttcctttaca
        23041 atcatatggt ttccaaccca ctaatggtgt tggttaccaa ccatacagag tagtagtact
        23101 ttcttttgaa cttctacatg caccagcaac tgtttgtgga cctaaaaagt ctactaattt
        23161 ggttaaaaac aaatgtgtca atttcaactt caatggttta acaggcacag gtgttcttac
        23221 tgagtctaac aaaaagtttc tgcctttcca acaatttggc agagacattg ctgacactac
        23281 tgatgctgtc cgtgatccac agacacttga gattcttgac attacaccat gttcttttgg
        23341 tggtgtcagt gttataacac caggaacaaa tacttctaac caggttgctg ttctttatca
        23401 ggatgttaac tgcacagaag tccctgttgc tattcatgca gatcaactta ctcctacttg
        23461 gcgtgtttat tctacaggtt ctaatgtttt tcaaacacgt gcaggctgtt taataggggc
        23521 tgaacatgtc aacaactcat atgagtgtga catacccatt ggtgcaggta tatgcgctag
        23581 ttatcagact cagactaatt ctcctcggcg ggcacgtagt gtagctagtc aatccatcat
        23641 tgcctacact atgtcacttg gtgcagaaaa ttcagttgct tactctaata actctattgc
        23701 catacccaca aattttacta ttagtgttac cacagaaatt ctaccagtgt ctatgaccaa
        23761 gacatcagta gattgtacaa tgtacatttg tggtgattca actgaatgca gcaatctttt
        23821 gttgcaatat ggcagttttt gtacacaatt aaaccgtgct ttaactggaa tagctgttga
        23881 acaagacaaa aacacccaag aagtttttgc acaagtcaaa caaatttaca aaacaccacc
        23941 aattaaagat tttggtggtt ttaatttttc acaaatatta ccagatccat caaaaccaag
        24001 caagaggtca tttattgaag atctactttt caacaaagtg acacttgcag atgctggctt
        24061 catcaaacaa tatggtgatt gccttggtga tattgctgct agagacctca tttgtgcaca
        24121 aaagtttaac ggccttactg ttttgccacc tttgctcaca gatgaaatga ttgctcaata
        24181 cacttctgca ctgttagcgg gtacaatcac ttctggttgg acctttggtg caggtgctgc
        24241 attacaaata ccatttgcta tgcaaatggc ttataggttt aatggtattg gagttacaca
        24301 gaatgttctc tatgagaacc aaaaattgat tgccaaccaa tttaatagtg ctattggcaa
        24361 aattcaagac tcactttctt ccacagcaag tgcacttgga aaacttcaag atgtggtcaa
        24421 ccaaaatgca caagctttaa acacgcttgt taaacaactt agctccaatt ttggtgcaat
        24481 ttcaagtgtt ttaaatgata tcctttcacg tcttgacaaa gttgaggctg aagtgcaaat
        24541 tgataggttg atcacaggca gacttcaaag tttgcagaca tatgtgactc aacaattaat
        24601 tagagctgca gaaatcagag cttctgctaa tcttgctgct actaaaatgt cagagtgtgt
        24661 acttggacaa tcaaaaagag ttgatttttg tggaaagggc tatcatctta tgtccttccc
        24721 tcagtcagca cctcatggtg tagtcttctt gcatgtgact tatgtccctg cacaagaaaa
        24781 gaacttcaca actgctcctg ccatttgtca tgatggaaaa gcacactttc ctcgtgaagg
        24841 tgtctttgtt tcaaatggca cacactggtt tgtaacacaa aggaattttt atgaaccaca
        24901 aatcattact acagacaaca catttgtgtc tggtaactgt gatgttgtaa taggaattgt
        24961 caacaacaca gtttatgatc ctttgcaacc tgaattagac tcattcaagg aggagttaga
        25021 taaatatttt aagaatcata catcaccaga tgttgattta ggtgacatct ctggcattaa
        25081 tgcttcagtt gtaaacattc aaaaagaaat tgaccgcctc aatgaggttg ccaagaattt
        25141 aaatgaatct ctcatcgatc tccaagaact tggaaagtat gagcagtata taaaatggcc
        25201 atggtacatt tggctaggtt ttatagctgg cttgattgcc atagtaatgg tgacaattat
        25261 gctttgctgt atgaccagtt gctgtagttg tctcaagggc tgttgttctt gtggatcctg
        25321 ctgcaaattt gatgaagacg actctgagcc agtgctcaaa ggagtcaaat tacattacac
        25381 ataaacgaac ttatggattt gtttatgaga atcttcacaa ttggaactgt aactttgaag
        25441 caaggtgaaa tcaaggatgc tactccttca gattttgttc gcgctactgc aacgataccg
        25501 atacaagcct cactcccttt cggatggctt attgttggcg ttgcacttct tgctgttttt
        25561 cagagcgctt ccaaaatcat aaccctcaaa aagagatggc aactagcact ctccaagggt
        25621 gttcactttg tttgcaactt gctgttgttg tttgtaacag tttactcaca ccttttgctc
        25681 gttgctgctg gccttgaagc cccttttctc tatctttatg ctttagtcta cttcttgcag
        25741 agtataaact ttgtaagaat aataatgagg ctttggcttt gctggaaatg ccgttccaaa
        25801 aacccattac tttatgatgc caactatttt ctttgctggc atactaattg ttacgactat
        25861 tgtatacctt acaatagtgt aacttcttca attgtcatta cttcaggtga tggcacaaca
        25921 agtcctattt ctgaacatga ctaccagatt ggtggttata ctgaaaaatg ggaatctgga
        25981 gtaaaagact gtgttgtatt acacagttac ttcacttcag actattacca gctgtactca
        26041 actcaattga gtacagacac tggtgttgaa catgttacct tcttcatcta caataaaatt
        26101 gttgatgagc ctgaagaaca tgtccaaatt cacacaatcg acggttcatc cggagttgtt
        26161 aatccagtaa tggaaccaat ttatgatgaa ccgacgacga ctactagcgt gcctttgtaa
        26221 gcacaagctg atgagtacga acttatgtac tcattcgttt cggaagagac aggtacgtta
        26281 atagttaata gcgtacttct ttttcttgct ttcgtggtat tcttgctagt tacactagcc
        26341 atccttactg cgcttcgatt gtgtgcgtac tgctgcaata ttgttaacgt gagtcttgta
        26401 aaaccttctt tttacgttta ctctcgtgtt aaaaatctga attcttctag agttcctgat
        26461 cttctggtct aaacgaacta aatattatat tagtttttct gtttggaact ttaattttag
        26521 ccatggcaga ttccaacggt actattaccg ttgaagagct taaaaagctc cttgaacaat
        26581 ggaacctagt aataggtttc ctattcctta catggatttg tcttctacaa tttgcctatg
        26641 ccaacaggaa taggtttttg tatataatta agttaatttt cctctggctg ttatggccag
        26701 taactttagc ttgttttgtg cttgctgctg tttacagaat aaattggatc accggtggaa
        26761 ttgctatcgc aatggcttgt cttgtaggct tgatgtggct cagctacttc attgcttctt
        26821 tcagactgtt tgcgcgtacg cgttccatgt ggtcattcaa tccagaaact aacattcttc
        26881 tcaacgtgcc actccatggc actattctga ccagaccgct tctagaaagt gaactcgtaa
        26941 tcggagctgt gatccttcgt ggacatcttc gtattgctgg acaccatcta ggacgctgtg
        27001 acatcaagga cctgcctaaa gaaatcactg ttgctacatc acgaacgctt tcttattaca
        27061 aattgggagc ttcgcagcgt gtagcaggtg actcaggttt tgctgcatac agtcgctaca
        27121 ggattggcaa ctataaatta aacacagacc attccagtag cagtgacaat attgctttgc
        27181 ttgtacagta agtgacaaca gatgtttcat ctcgttgact ttcaggttac tatagcagag
        27241 atattactaa ttattatgag gacttttaaa gtttccattt ggaatcttga ttacatcata
        27301 aacctcataa ttaaaaattt atctaagtca ctaactgaga ataaatattc tcaattagat
        27361 gaagagcaac caatggagat tgattaaacg aacatgaaaa ttattctttt cttggcactg
        27421 ataacactcg ctacttgtga gctttatcac taccaagagt gtgttagagg tacaacagta
        27481 cttttaaaag aaccttgctc ttctggaaca tacgagggca attcaccatt tcatcctcta
        27541 gctgataaca aatttgcact gacttgcttt agcactcaat ttgcttttgc ttgtcctgac
        27601 ggcgtaaaac acgtctatca gttacgtgcc agatcagttt cacctaaact gttcatcaga
        27661 caagaggaag ttcaagaact ttactctcca atttttctta ttgttgcggc aatagtgttt
        27721 ataacacttt gcttcacact caaaagaaag acagaatgat tgaactttca ttaattgact
        27781 tctatttgtg ctttttagcc tttctgctat tccttgtttt aattatgctt attatctttt
        27841 ggttctcact tgaactgcaa gatcataatg aaacttgtca cgcctaaacg aacatgaaat
        27901 ttcttgtttt cttaggaatc atcacaactg tagctgcatt tcaccaagaa tgtagtttac
        27961 agtcatgtac tcaacatcaa ccatatgtag ttgatgaccc gtgtcctatt cacttctatt
        28021 ctaaatggta tattagagta ggagctagaa aatcagcacc tttaattgaa ttgtgcgtgg
        28081 atgaggctgg ttctaaatca cccattcagt acatcgatat cggtaattat acagtttcct
        28141 gtttaccttt tacaattaat tgccaggaac ctaaattggg tagtcttgta gtgcgttgtt
        28201 cgttctatga agacttttta gagtatcatg acgttcgtgt tgttttagat ttcatctaaa
        28261 cgaacaaact aaaatgtctg ataatggacc ccaaaatcag cgaaatgcac cccgcattac
        28321 gtttggtgga ccctcagatt caactggcag taaccagaat ggagaacgca gtggggcgcg
        28381 atcaaaacaa cgtcggcccc aaggtttacc caataatact gcgtcttggt tcaccgctct
        28441 cactcaacat ggcaaggaag accttaaatt ccctcgagga caaggcgttc caattaacac
        28501 caatagcagt ccagatgacc aaattggcta ctaccgaaga gctaccagac gaattcgtgg
        28561 tggtgacggt aaaatgaaag atctcagtcc aagatggtat ttctactacc taggaactgg
        28621 gccagaagct ggacttccct atggtgctaa caaagacggc atcatatggg ttgcaactga
        28681 gggagccttg aatacaccaa aagatcacat tggcacccgc aatcctgcta acaatgctgc
        28741 aatcgtgcta caacttcctc aaggaacaac attgccaaaa ggcttctacg cagaagggag
        28801 cagaggcggc agtcaagcct cttctcgttc ctcatcacgt agtcgcaaca gttcaagaaa
        28861 ttcaactcca ggcagcagta ggggaacttc tcctgctaga atggctggca atggcggtga
        28921 tgctgctctt gctttgctgc tgcttgacag attgaaccag cttgagagca aaatgtctgg
        28981 taaaggccaa caacaacaag gccaaactgt cactaagaaa tctgctgctg aggcttctaa
        29041 gaagcctcgg caaaaacgta ctgccactaa agcatacaat gtaacacaag ctttcggcag
        29101 acgtggtcca gaacaaaccc aaggaaattt tggggaccag gaactaatca gacaaggaac
        29161 tgattacaaa cattggccgc aaattgcaca atttgccccc agcgcttcag cgttcttcgg
        29221 aatgtcgcgc attggcatgg aagtcacacc ttcgggaacg tggttgacct acacaggtgc
        29281 catcaaattg gatgacaaag atccaaattt caaagatcaa gtcattttgc tgaataagca
        29341 tattgacgca tacaaaacat tcccaccaac agagcctaaa aaggacaaaa agaagaaggc
        29401 tgatgaaact caagccttac cgcagagaca gaagaaacag caaactgtga ctcttcttcc
        29461 tgctgcagat ttggatgatt tctccaaaca attgcaacaa tccatgagca gtgctgactc
        29521 aactcaggcc taaactcatg cagaccacac aaggcagatg ggctatataa acgttttcgc
        29581 ttttccgttt acgatatata gtctactctt gtgcagaatg aattctcgta actacatagc
        29641 acaagtagat gtagttaact ttaatctcac atagcaatct ttaatcagtg tgtaacatta
        29701 gggaggactt gaaagagcca ccacattttc accgaggcca cgcggagtac gatcgagtgt
        29761 acagtgaaca atgctaggga gagctgccta tatggaagag ccctaatgtg taaaattaat
        29821 tttagtagtg ctatccccat gtgattttaa tagcttctta ggagaatgac aaaaaaaaaa
        29881 aaaaaaaaaa aaaaaaaaaa aaa
    //
    

    Souce: 美賽生物    2020-01-29

    色欧美片视频在线观看_日本一区二区性视频_精品福利视频一区二区三区_欧美牲交A欧美牲交
  • <tr id="7r76l"></tr>
    <ins id="7r76l"><option id="7r76l"><menu id="7r76l"></menu></option></ins>
  • <ins id="7r76l"></ins>
    <ruby id="7r76l"><nav id="7r76l"></nav></ruby>
    <mark id="7r76l"></mark>
  • <menuitem id="7r76l"></menuitem>
    <output id="7r76l"><track id="7r76l"><delect id="7r76l"></delect></track></output>

    <menuitem id="7r76l"></menuitem>